Structure of PDB 4ysh Chain B

Receptor sequence

>4yshB (length=368) Species: 235909 (Geobacillus kaustophilus HTA426)

THRYDVAIVGGGVIGAAIGFELAKRRHRVAIFEKGTMGSGASSAAAGMLG
AQSEFSTSSPLVPLALQSRALMPALAEELRERTGIDIGLVEKGLIKLATT
EEEADDLYRHYTFWRGIGEPVQWLTKGEALEMEPRLAEALAGAMYIPGDG
QVSAPDLAAALAYAAASAGACLYEYTEVFDIRSDSSGHVLDTTGGTFAAE
AVVIASGAWAARLGARVGLSLSVYPVKGECVMVRAPVPLLQTTVFAKNGC
YIVPKSGNRLLIGATSTPGTFDRRVSAGGVMNLLHRAAHLVPDIEQAEWV
ASWSGIRPQTEDGLPYLGEHPERRGLFVAAGHYRNGILLSPLTGLLVADL
VERKETAFDLAPFSLTRH

3D structure

• PDB: 4ysh Crystal structure of glycine oxidase from Geobacillus kaustophilus
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A46 M49 L50 Q53 I264 L285 G307 N337 L340
• Catalytic site (residue number reindexed from 1): A45 M48 L49 Q52 I262 L283 G305 N335 L338
• Enzyme Commision number: 1.4.3.19: glycine oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLY	B	G251 Y253 A266 R336	G249 Y251 A264 R334
BS02	GLY	B	Y253 R309 R336	Y251 R307 R334
BS03	FAD	B	V10 G11 G13 I15 F33 E34 K35 G41 A42 S43 A46 A47 M49 V180 S208 W211 R309 H334 R336 N337 G338 I339 L340	V9 G10 G12 I14 F32 E33 K34 G40 A41 S42 A45 A46 M48 V178 S206 W209 R307 H332 R334 N335 G336 I337 L338

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0043799 glycine oxidase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0009228 thiamine biosynthetic process
• GO:0009229 thiamine diphosphate biosynthetic process
• GO:0051289 protein homotetramerization

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4ysh, PDBe:4ysh, PDBj:4ysh
• PDBsum: 4ysh
• UniProt: Q5L2C2|GLYOX_GEOKA Glycine oxidase (Gene Name=thiO)