Structure of PDB 4ypo Chain B

Receptor sequence

>4ypoB (length=325) Species: 1773 (Mycobacterium tuberculosis)

MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRS
RPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDA
LFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAV
EQDPRGDGLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGT
EELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYYSVSD
TAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLE
ELRRQNAEHPIEVVGKKLRDLMSWV

3D structure

• PDB: 4ypo Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
• Chain: B
• Resolution: 1.001 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K128 D188 E192
• Catalytic site (residue number reindexed from 1): K128 D188 E192
• Enzyme Commision number: 1.1.1.86: ketol-acid reductoisomerase (NADP(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	E224 E228	E224 E228
BS02	MG	B	D188 E192	D188 E192

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004455 ketol-acid reductoisomerase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:4ypo, PDBe:4ypo, PDBj:4ypo
• PDBsum: 4ypo
• PubMed: 26876563
• UniProt: P9WKJ7|ILVC_MYCTU Ketol-acid reductoisomerase (NADP(+)) (Gene Name=ilvC)