Structure of PDB 4yj0 Chain B

Receptor sequence
>4yj0B (length=63) Species: 9606 (Homo sapiens) [Search protein sequence]
KSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQ
VALRRQQAQEEEL
3D structure
PDB4yj0 An ancient protein-DNA interaction underlying metazoan sex determination.
ChainB
Resolution3.814 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R72 P74 K89 K92 R122 R4 P6 K21 K24 R54
BS02 dna B S70 R72 K75 A77 R80 R111 Q112 R123 S2 R4 K7 A9 R12 R43 Q44 R55
BS03 ZN B H82 C100 C105 H14 C32 C37
BS04 ZN B C76 H91 C95 C8 H23 C27
Gene Ontology
Molecular Function
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yj0, PDBe:4yj0, PDBj:4yj0
PDBsum4yj0
PubMed26005864
UniProtQ9Y5R6|DMRT1_HUMAN Doublesex- and mab-3-related transcription factor 1 (Gene Name=DMRT1)

[Back to BioLiP]