Structure of PDB 4ybh Chain B

Receptor sequence

>4ybhB (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]

ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDA
EIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

3D structure

PDB

4ybh The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	B	H17 H27	H16 H26
BS02	CA	B	S20 E23 D25 T28 E33	S19 E22 D24 T27 E32
BS03	CA	B	D61 N63 D65 E67 E72	D60 N62 D64 E66 E71

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0008270	zinc ion binding
GO:0015075	monoatomic ion transmembrane transporter activity
GO:0042803	protein homodimerization activity
GO:0044548	S100 protein binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding

	Biological Process
GO:0007165	signal transduction
GO:0007409	axonogenesis
GO:0034220	monoatomic ion transmembrane transport
GO:0048146	positive regulation of fibroblast proliferation

	Cellular Component
GO:0001726	ruffle
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0009898	cytoplasmic side of plasma membrane
GO:0048471	perinuclear region of cytoplasm
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome

External links

PDB	RCSB:4ybh, PDBe:4ybh, PDBj:4ybh
PDBsum	4ybh
PubMed	27818100
UniProt	P06703\|S10A6_HUMAN Protein S100-A6 (Gene Name=S100A6)