Structure of PDB 4yai Chain B

Receptor sequence

>4yaiB (length=273) Species: 627192 (Sphingobium sp. SYK-6) [Search protein sequence]

MDIAGTTAFITGGASGIGFGIAQRLLANGARLVLADIRQDHLDEARQFFE
ERQQGRNVHTIRLDVSDRAQMAEAARECEAVMGGPDILINNAGIDPSGPF
KDATYQDWDYGLAINLMGPINGIMAFTPGMRARGRGGHIVNTASLAGLTP
MPSFMAIYATAKAAVITLTETIRDSMAEDNIGVTVLMPGPIKSRIHESGQ
NRPERFRAGSGLAETEQQLAKRVVADNWMEPTEVGDMIVDAIVHNKLYVS
THGNWRETCEARFQALLDSMPEA

3D structure

PDB

4yai Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.

Chain

Resolution

1.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S144 Y158 K162 P203
Catalytic site (residue number reindexed from 1)	S144 Y158 K162 P203
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	B	G12 S15 G16 I17 D36 I37 H41 L63 D64 V65 N91 A92 G93 T142 S144 Y158 K162 P188 G189 P190 I191 S193 R194 I195	G12 S15 G16 I17 D36 I37 H41 L63 D64 V65 N91 A92 G93 T142 S144 Y158 K162 P188 G189 P190 I191 S193 R194 I195
BS02	GGE	B	D95 S144 M151 M155 Y158 P188 G189 R222 W228 W255	D95 S144 M151 M155 Y158 P188 G189 R222 W228 W255

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0016491	oxidoreductase activity

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4yai, PDBe:4yai, PDBj:4yai
PDBsum	4yai
PubMed	26940872
UniProt	C0SUJ9

[Back to BioLiP]