Structure of PDB 4y91 Chain B |
>4y91B (length=66) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
NLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLI YKHAISTIIPSSYVML |
|
PDB | 4y91 Crystal Structure of a Thermotoga maritima Hfq homolog |
Chain | B |
Resolution | 2.656 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
Q10 S43 Y44 H60 |
Q3 S36 Y37 H53 |
|
|
|
|