Structure of PDB 4y91 Chain B

Receptor sequence

>4y91B (length=66) Species: 243274 (Thermotoga maritima MSB8)

NLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLI
YKHAISTIIPSSYVML

3D structure

• PDB: 4y91 Crystal Structure of a Thermotoga maritima Hfq homolog
• Chain: B
• Resolution: 2.656 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	Q10 S43 Y44 H60	Q3 S36 Y37 H53

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0043487 regulation of RNA stability
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4y91, PDBe:4y91, PDBj:4y91
• PDBsum: 4y91
• UniProt: Q9WYZ6|HFQ_THEMA RNA-binding protein Hfq (Gene Name=hfq)