Structure of PDB 4xwz Chain B

Receptor sequence

>4xwzB (length=436) Species: 746128 (Aspergillus fumigatus)

STESSIIVIGAGTWGCSTALHLARRGYKDVTVLDPHPVPSPIAAGNDINK
IMEHSELKDGSSDPRSAAFSTFTRAALKAWKTDPVFQPYFHETGFIISGH
TPALIDHIRKDEVEPSETNFVKLETAEDFRRTMPPGVLTGDFPGWKGWLH
KSGAGWIHAKKAMISAFNEAKRLGVRFVTGSPEGNVVSLVYEDGDVVGAR
TADGRVHKAHRTILSAGAGSDSLLDFKKQLRPTAWTLCHIQMGPEEVKQY
RNLPVLFNIAKGFFMEPDEDKHELKICDEHPGYCNFLPDPNRPGQEKSVP
FAKHQIPLEAEARARDFLHDTMPHLADRPLSFARICWDADTPDRAFLIDR
HPEHPSLLVAVGGSGNGAMQMPTIGGFIADALESKLQKEVKDIVRWRPET
AVDRDWRATQNRFGGPDRIMDFQQVGEDQWTKIGES

3D structure

• PDB: 4xwz Crystal structure of the deglycating enzyme Amadoriase I in its free form and substrate-bound complex.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N52 N55 K56
• Catalytic site (residue number reindexed from 1): N46 N49 K50

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	I15 G16 T19 W20 D40 P41 S46 I48 A49 A50 G51 K56 I57 V192 A222 G223 C342 D344 G371 N372 G373 A374 M375	I9 G10 T13 W14 D34 P35 S40 I42 A43 A44 G45 K50 I51 V186 A216 G217 C336 D338 G365 N366 G367 A368 M369
BS02	LYS	B	G371 N372	G365 N366
BS03	BDF	B	W241 F269 E285 R418	W235 F263 E279 R412

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008115 sarcosine oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051698 saccharopine oxidase activity

External links

• PDB: RCSB:4xwz, PDBe:4xwz, PDBj:4xwz
• PDBsum: 4xwz
• PubMed: 26873906
• UniProt: O42629