Structure of PDB 4xsd Chain B

Receptor sequence

>4xsdB (length=277) Species: 341980 (Human herpesvirus 3 strain Oka vaccine)

TLTGELQYLKQVDDILRYGVRKRDGIGTLSLFGMQARYNLRNEFPLLTTK
RVFWRAVVEELLWFIRGSTDSKELAAKDIHIWDIYGSSKFLNRNGFHKRH
TGDLGPIYGFQWRHFGAEYKSNYLQQGIDQLQTVIDTIKTNPESRRMIIS
SWNPKDIPLMVLPPCHTLCQFYVANGELSCQVYQRSGDMGLGVPFNIAGY
ALLTYIVAHVTGLKTGDLIHTMGDAHIYLNHIDALKVQLARSPKPFPCLK
IIRNVTDINDFKWDDFQLDGYNPHPPL

3D structure

• PDB: 4xsd Structure of the Varicella Zoster Virus Thymidylate Synthase Establishes Functional and Structural Similarities as the Human Enzyme and Potentiates Itself as a Target of Brivudine.
• Chain: B
• Resolution: 2.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E75 W97 Y123 C183 R203 D206
• Catalytic site (residue number reindexed from 1): E60 W82 Y108 C165 R185 D188
• Enzyme Commision number: 2.1.1.45: thymidylate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UMP	B	R163 R164	R145 R146
BS02	UMP	B	C183 Q202 R203 G205 D206 N214 H244 Y246	C165 Q184 R185 G187 D188 N196 H226 Y228

Gene Ontology

Molecular Function

• GO:0004799 thymidylate synthase activity
• GO:0008168 methyltransferase activity
• GO:0016741 transferase activity, transferring one-carbon groups

Biological Process

• GO:0006231 dTMP biosynthetic process
• GO:0006235 dTTP biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0032259 methylation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4xsd, PDBe:4xsd, PDBj:4xsd
• PDBsum: 4xsd
• PubMed: 26630264
• UniProt: Q4JQW2|TYSY_VZVO Thymidylate synthase (Gene Name=ORF13)