Structure of PDB 4xpj Chain B

Receptor sequence

>4xpjB (length=105) Species: 10090 (Mus musculus)

EFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRA
SNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVC
VLSRK

3D structure

• PDB: 4xpj The structure of nerve growth factor in complex with lysophosphatidylinositol
• Chain: B
• Resolution: 2.605 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LPY	B	F49 R50 Y52 W99	F39 R40 Y42 W89	PDBbind-CN: -logKd/Ki=5.09,Kd~8.11uM

Gene Ontology

Molecular Function

• GO:0005102 signaling receptor binding

External links

• PDB: RCSB:4xpj, PDBe:4xpj, PDBj:4xpj
• PDBsum: 4xpj
• PubMed: 26144237
• UniProt: P01139|NGF_MOUSE Beta-nerve growth factor (Gene Name=Ngf)