Structure of PDB 4xe5 Chain B

Receptor sequence

>4xe5B (length=281) Species: 9913 (Bos taurus) [Search protein sequence]

SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTY
QDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQK
DDMIFEDCGNVPSELKDRGELNNEQGERKVCRFKLEWLGNCSGINDETYG
YKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRD
EDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTM
DTEIRIECKAYGENIGYSEKDRFQGRFDVKI

3D structure

PDB

4xe5 Isolation, crystallization and crystal structure determination of bovine kidney Na(+),K(+)-ATPase.

Chain

Resolution

3.901 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	B	V56 T60	V38 T42

Gene Ontology

	Molecular Function
GO:0001671	ATPase activator activity
GO:0005391	P-type sodium:potassium-exchanging transporter activity
GO:0019901	protein kinase binding
GO:0030674	protein-macromolecule adaptor activity
GO:0051117	ATPase binding

	Biological Process
GO:0006813	potassium ion transport
GO:0006814	sodium ion transport
GO:0006874	intracellular calcium ion homeostasis
GO:0006883	intracellular sodium ion homeostasis
GO:0007155	cell adhesion
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient
GO:0010468	regulation of gene expression
GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
GO:0030007	intracellular potassium ion homeostasis
GO:0032781	positive regulation of ATP-dependent activity
GO:0035725	sodium ion transmembrane transport
GO:0036376	sodium ion export across plasma membrane
GO:0046034	ATP metabolic process
GO:0050821	protein stabilization
GO:0055119	relaxation of cardiac muscle
GO:0060048	cardiac muscle contraction
GO:0072659	protein localization to plasma membrane
GO:0086009	membrane repolarization
GO:0098655	monoatomic cation transmembrane transport
GO:1901018	positive regulation of potassium ion transmembrane transporter activity
GO:1903169	regulation of calcium ion transmembrane transport
GO:1903278	positive regulation of sodium ion export across plasma membrane
GO:1903288	positive regulation of potassium ion import across plasma membrane
GO:1903408	positive regulation of P-type sodium:potassium-exchanging transporter activity
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0005886	plasma membrane
GO:0005890	sodium:potassium-exchanging ATPase complex
GO:0014704	intercalated disc
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016324	apical plasma membrane
GO:0016328	lateral plasma membrane
GO:0030315	T-tubule
GO:0031090	organelle membrane
GO:0036126	sperm flagellum
GO:0042383	sarcolemma

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4xe5, PDBe:4xe5, PDBj:4xe5
PDBsum	4xe5
PubMed	27050261
UniProt	G3MWR4

[Back to BioLiP]