Structure of PDB 4xdz Chain B

Receptor sequence

>4xdzB (length=329) Species: 583356 (Ignisphaera aggregans DSM 17230)

AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQG
DSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKG
ADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALV
AVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVG
GIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAV
SDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPT
VFKELSELEGSTIETVGRKLREMMFRGMK

3D structure

• PDB: 4xdz Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
• Chain: B
• Resolution: 1.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K131 D191 E195
• Catalytic site (residue number reindexed from 1): K130 D190 E194
• Enzyme Commision number: 1.1.1.383: ketol-acid reductoisomerase [NAD(P)(+)].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	40E	B	E231 V251 S252 A255	E230 V250 S251 A254
BS02	NDP	B	Y25 G26 S27 Q28 E48 R49 S53 L80 V81 P82 D83 V85 A107 H108 P133	Y24 G25 S26 Q27 E47 R48 S52 L79 V80 P81 D82 V84 A106 H107 P132
BS03	MG	B	D191 E195	D190 E194
BS04	40E	B	P133 D191 E195	P132 D190 E194

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004455 ketol-acid reductoisomerase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

External links

• PDB: RCSB:4xdz, PDBe:4xdz, PDBj:4xdz
• PDBsum: 4xdz
• PubMed: 25849365
• UniProt: E0SRA9|ILVC_IGNAA Ketol-acid reductoisomerase (NAD(P)(+)) (Gene Name=ilvC)