Structure of PDB 4xdv Chain B |
>4xdvB (length=145) Species: 1833 (Rhodococcus erythropolis) [Search protein sequence] |
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQ NMPLPPAYGRDAVEQTLAGFFTVVSVDAVETFHIGSSNGLVYTERVDVLR ALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG |
|
PDB | 4xdv Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution |
Chain | B |
Resolution | 2.25 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
40O |
B |
Y53 F74 |
Y49 F70 |
|
|
|
|