Structure of PDB 4xc4 Chain B

Receptor sequence

>4xc4B (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 4xc4 Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide
• Chain: B
• Resolution: 1.499 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28	F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4xc4, PDBe:4xc4, PDBj:4xc4
• PDBsum: 4xc4
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)