Structure of PDB 4xc2 Chain B

Receptor sequence
>4xc2B (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]
AMGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKY
LVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH
EEDFFLYIAYSDESVYG
3D structure
PDB4xc2 CUL3-KBTBD6/KBTBD7 Ubiquitin Ligase Cooperates with GABARAP Proteins to Spatially Restrict TIAM1-RAC1 Signaling.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Y5 H9 E17 Y25 R28 P30 D45 K46 K47 K48 Y49 L50 P52 L63 F104 Y6 H10 E18 Y26 R29 P31 D46 K47 K48 K49 Y50 L51 P53 L64 F105
BS02 peptide B N82 S113 V114 Y115 G116 N83 S114 V115 Y116 G117
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000226 microtubule cytoskeleton organization
GO:0000422 autophagy of mitochondrion
GO:0006605 protein targeting
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006995 cellular response to nitrogen starvation
GO:0007268 chemical synaptic transmission
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031 protein transport
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020 regulation of Rac protein signal transduction
GO:0097352 autophagosome maturation
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524 positive regulation of protein K48-linked ubiquitination
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005790 smooth endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0097225 sperm midpiece
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xc2, PDBe:4xc2, PDBj:4xc2
PDBsum4xc2
PubMed25684205
UniProtO95166|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)

[Back to BioLiP]