Structure of PDB 4wzv Chain B

Receptor sequence

>4wzvB (length=158) Species: 9606 (Homo sapiens)

GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYS
RDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWS
LGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDV
NGIRHLYG

3D structure

• PDB: 4wzv N-O-Isopropyl Sulfonamido-Based Hydroxamates as Matrix Metalloproteinase Inhibitors: Hit Selection and in Vivo Antiangiogenic Activity.
• Chain: B
• Resolution: 1.65 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H226 E227 H230 H236
• Catalytic site (residue number reindexed from 1): H115 E116 H119 H125
• Enzyme Commision number: 3.4.24.35: gelatinase B.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	E40	B	Y245 P246	Y134 P135	MOAD: ic50=0.43nM BindingDB: IC50=0.430000nM
BS02	E40	B	L187 A189 H190 A191 H226 E227 H230 H236 L243 Y245 P246 M247 Y248	L76 A78 H79 A80 H115 E116 H119 H125 L132 Y134 P135 M136 Y137	MOAD: ic50=0.43nM BindingDB: IC50=0.430000nM
BS03	ZN	B	H226 H230 H236	H115 H119 H125
BS04	ZN	B	H175 D177 H190 H203	H64 D66 H79 H92
BS05	CA	B	D165 G197 Q199 D201	D54 G86 Q88 D90
BS06	CA	B	D131 D206 E208	D20 D95 E97
BS07	CA	B	D182 G183 D185 L187 D205 E208	D71 G72 D74 L76 D94 E97

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:4wzv, PDBe:4wzv, PDBj:4wzv
• PDBsum: 4wzv
• PubMed: 26263024
• UniProt: P14780|MMP9_HUMAN Matrix metalloproteinase-9 (Gene Name=MMP9)