Structure of PDB 4wzs Chain B |
>4wzsB (length=113) Species: 6035 (Encephalitozoon cuniculi) [Search protein sequence] |
LPKATVDKMVSSSVVPKESKEIFQNACIYFLNMLTLEANKACEEEKKKTI SYEHVYKALKNLGFESYVESCMKEHENYESYIKQKDSGLTMEELHSQQIK LFQNAKLQFERSF |
|
PDB | 4wzs Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1. |
Chain | B |
Resolution | 3.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
A15 T16 |
A4 T5 |
|
BS02 |
dna |
B |
K63 K64 |
K47 K48 |
|
|
|
|