Structure of PDB 4wx2 Chain B

Receptor sequence

>4wx2B (length=395) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)

TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKN
YAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRM
GKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRL
MGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIV
REFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVG
LIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALES
SHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGE

3D structure

• PDB: 4wx2 Visualizing the tunnel in tryptophan synthase with crystallography: Insights into a selective filter for accommodating indole and rejecting water.
• Chain: B
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K87 E109 S377
• Catalytic site (residue number reindexed from 1): K86 E108 S376
• Enzyme Commision number: 4.2.1.20: tryptophan synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F6F	B	I20 L21	I19 L20
BS02	PLP	B	H86 K87 T190 G232 G234 S235 N236 E350 S377 G378	H85 K86 T189 G231 G233 S234 N235 E349 S376 G377
BS03	F6F	B	K87 E109 T110 G111 H115 C170 Y186 L188 G189 T190 F280 F306	K86 E108 T109 G110 H114 C169 Y185 L187 G188 T189 F279 F305

Gene Ontology

Molecular Function

• GO:0004834 tryptophan synthase activity
• GO:0005515 protein binding
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0000162 tryptophan biosynthetic process
• GO:0006568 tryptophan metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4wx2, PDBe:4wx2, PDBj:4wx2
• PDBsum: 4wx2
• PubMed: 26708480
• UniProt: P0A2K1|TRPB_SALTY Tryptophan synthase beta chain (Gene Name=trpB)