Structure of PDB 4wuo Chain B

Receptor sequence

>4wuoB (length=345) Species: 300852 (Thermus thermophilus HB8)

MKVAVLPGDGIGPEVTEAALKVLRALDEAEGLGLAYEVFPFGGAAIDAFG
EPFPEPTRKGVEEAEAVLLGSVGGPKWDGLPRKIRPETGLLSLRKSQDLF
ANLRPAKVFPGLERLSPLKEEIARGVDVLIVRELTGGIYFGEPRGMSEAE
AWNTERYSKPEVERVARVAFEAARKRRKHVVSVDKANVLEVGEFWRKTVE
EVGRGYPDVALEHQYVDAMAMHLVRSPARFDVVVTGNIFGDILSDLASVL
PGSLGLLPSASLGRGTPVFAPVHGSAPDIAGKGIANPTAAILSAAMMLEH
AFGLVELARKVEDAVAKALLETPPPDLGGSAGTEAFTATVLRHLA

3D structure

• PDB: 4wuo Glutamate 270 plays an essential role in K(+)-activation and domain closure of Thermus thermophilus isopropylmalate dehydrogenase.
• Chain: B
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y139 K185 D217 D241 D245
• Catalytic site (residue number reindexed from 1): Y139 K185 D217 D241 D245
• Enzyme Commision number: 1.1.1.85: 3-isopropylmalate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IPM	B	R94 R104 R132 Y139 D241	R94 R104 R132 Y139 D241
BS02	NAD	B	I11 V72 G73 E87 L90 G255 H273 G274 S275 A276 D278 I279 N286	I11 V72 G73 E87 L90 G255 H273 G274 S275 A276 D278 I279 N286

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003862 3-isopropylmalate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:0051287 NAD binding

Biological Process

• GO:0009098 L-leucine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4wuo, PDBe:4wuo, PDBj:4wuo
• PDBsum: 4wuo
• PubMed: 25497013
• UniProt: Q5SIY4|LEU3_THET8 3-isopropylmalate dehydrogenase (Gene Name=leuB)