Structure of PDB 4wkx Chain B |
>4wkxB (length=128) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGENWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALHKGTLTLK |
|
PDB | 4wkx Reversible S-Nitrosylation in an Engineered Mutant of Pseudomonas aeruginosa Azurin with Red Copper Site |
Chain | B |
Resolution | 1.94 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
C112 H117 H121 |
C112 H117 H121 |
|
|
|
|