Structure of PDB 4wcg Chain B |
>4wcgB (length=61) Species: 180230 (Cyprinid herpesvirus 3) [Search protein sequence] |
PISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVR KHPQHPVWYLP |
|
PDB | 4wcg The Structure of the Cyprinid herpesvirus 3 ORF112-Z alpha Z-DNA Complex Reveals a Mechanism of Nucleic Acids Recognition Conserved with E3L, a Poxvirus Inhibitor of Interferon Response. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
B |
S250 N253 R254 Y257 |
S34 N37 R38 Y41 |
|
|
|
|