Structure of PDB 4v2s Chain B

Receptor sequence

>4v2sB (length=70) Species: 83333 (Escherichia coli K-12)

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTV
SQMVYKHAISTVVPSRPVSH

3D structure

• PDB: 4v2s Recognition of the small regulatory RNA RydC by the bacterial Hfq protein.
• Chain: B
• Resolution: 3.48 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	Q41 F42 H57	Q41 F42 H57

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003677 DNA binding
• GO:0003681 bent DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0140691 RNA folding chaperone

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0008033 tRNA processing
• GO:0034337 RNA folding
• GO:0040033 sRNA-mediated post-transcriptional gene silencing
• GO:0043487 regulation of RNA stability
• GO:0045974 regulation of translation, ncRNA-mediated
• GO:0045975 positive regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol
• GO:0043590 bacterial nucleoid

External links

• PDB: RCSB:4v2s, PDBe:4v2s, PDBj:4v2s
• PDBsum: 4v2s
• PubMed: 25551292
• UniProt: P0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)