Structure of PDB 4v0u Chain B

Receptor sequence
>4v0uB (length=364) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
DEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHSYVGDEAQSK
RGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLN
PKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTH
NVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRD
IKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETL
FQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIAD
RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQE
YDEAGPSIVHRKCF
3D structure
PDB4v0u G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
ChainB
Resolution7.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 LAB B G15 L16 P32 Q59 Y69 D157 R183 T186 R206 E207 R210 G15 L16 P32 Q48 Y58 D146 R172 T175 R195 E196 R199 BindingDB: IC50=8470nM
BS02 ATP B G13 S14 G15 L16 K18 G156 D157 G158 V159 G182 R210 K213 E214 G302 M305 Y306 K336 G13 S14 G15 L16 K18 G145 D146 G147 V148 G171 R199 K202 E203 G291 M294 Y295 K325
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v0u, PDBe:4v0u, PDBj:4v0u
PDBsum4v0u
PubMed25774600
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]