Structure of PDB 4uw4 Chain B |
>4uw4B (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNP RLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVG DAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
|
PDB | 4uw4 Structural Basis of Multivalent Galactose-Based Dendrimer Recognition by Human Galectin-7. |
Chain | B |
Resolution | 1.766 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4S0 |
B |
H49 R53 E72 |
H47 R51 E70 |
|
|
|
|