Structure of PDB 4usi Chain B

Receptor sequence
>4usiB (length=111) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
IQCDLSAFPGVKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVGV
QGGSFGPSNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHP
VAEVVRIRTAE
3D structure
PDB4usi A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
ChainB
Resolution1.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B I24 G52 V53 G54 V55 Q56 I104 G105 D106 G107 K108 I19 G47 V48 G49 V50 Q51 I91 G92 D93 G94 K95
BS02 AKG B G54 Q56 G58 K76 G105 G49 Q51 G53 K63 G92 MOAD: Kd=38.9uM
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Dec 18 21:16:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4usi', asym_id = 'B', title = 'A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4usi', asym_id='B', title='A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006808,0030234', uniprot = '', pdbid = '4usi', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006808,0030234', uniprot='', pdbid='4usi', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>