Structure of PDB 4u03 Chain B

Receptor sequence

>4u03B (length=385) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

RMTWNFHQYYTNRNDGLMGKLVLTDEEKNNLKALRKIIRLRTRDVFEEAK
GIAKAVKKSALTFEIIQEKVSTTQIKHLSDSEQREVAKLIYEMDDDARDE
FLGLTPRFWTQGSFQYDTLNRPFQPGQEMDIDDGTYMPMPIFESEPKIGH
SLLILLVDASLKSLVAENHGWKFEAKQTCGRIKIEAEKTHIDVPMYAIPK
DEFQKKQIALTYELDSENVNLALREGDRKWINSDPKIVEDWFNDSCIRIG
KHLRKVCRFMKAWRDAQWDVGGPSSISLMAATVNILDSVAHDASDLGETM
KIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEI
LSSAESADSKSEALKKINMAFGNRVTNSELIVLAK

3D structure

• PDB: 4u03 Structural Biochemistry of a Vibrio cholerae Dinucleotide Cyclase Reveals Cyclase Activity Regulation by Folates.
• Chain: B
• Resolution: 2.041 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	Q112 G113 S114 Y117 K287 S301 D348	Q111 G112 S113 Y116 K261 S275 D322
BS02	GTP	B	Q112 D133 K177 T179 C180 D193 Y197 S259	Q111 D132 K176 T178 C179 D192 Y196 S233
BS03	MG	B	D131 D133	D130 D132
BS04	MG	B	D131 D133 D193	D130 D132 D192
BS05	TLL	B	R40 R108 F109 W110 T111 Q116 Y137 F204 Y238 L240 D260 P261 K262	R39 R107 F108 W109 T110 Q115 Y136 F203 Y212 L214 D234 P235 K236	MOAD: ic50=1.69uM

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0052621 diguanylate cyclase activity
• GO:0140701 3',3'-cyclic GMP-AMP synthase activity

Biological Process

• GO:0009117 nucleotide metabolic process
• GO:0009190 cyclic nucleotide biosynthetic process
• GO:0050922 negative regulation of chemotaxis
• GO:0051607 defense response to virus

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4u03, PDBe:4u03, PDBj:4u03
• PDBsum: 4u03
• PubMed: 25201413
• UniProt: Q9KVG7|DNCV_VIBCH Cyclic GMP-AMP synthase (Gene Name=dncV)