Structure of PDB 4ty0 Chain B

Receptor sequence

>4ty0B (length=362) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

TWNFHQYYTNRNDGLMGKLVLTDEEKNNLKALRKIIRLRTRDVFEEAKGI
AKAVKKSALTFEIIQEKVSTTQIKHLSDSEQREVAKLIYEMDDDARDEFL
GLTPRFWTQGSFQYDTLNRPFQPGQEMDIDDGTYMPMPGHSLLILLVDAS
LKSLVAENHGWKFEAKQTCGRIKIEAEKTHIDVPMYAIPKDEFSENVNLA
LREGDRKWINSDPKIVEDWFNDSCIRIGKHLRKVCRFMKAWRDAQWDVGG
PSSISLMAATVNILDSVAHDASDLGETMKIIAKHLPSEFARGVESPDSTD
EKPLFPPSYKHGPREMDIMSKLERLPEILSSAESADSKSEALKKINMAFG
NRVTNSELIVLA

3D structure

• PDB: 4ty0 Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D132 D134 D194	D128 D130 D182
BS02	MG	B	D132 D134	D128 D130
BS03	38V	B	Q113 G114 S115 Y118 D132 D134 K178 T180 C181 Y198 L248 S260 K288 S302	Q109 G110 S111 Y114 D128 D130 K166 T168 C169 Y186 L199 S211 K239 S253

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0052621 diguanylate cyclase activity
• GO:0140701 3',3'-cyclic GMP-AMP synthase activity

Biological Process

• GO:0009117 nucleotide metabolic process
• GO:0009190 cyclic nucleotide biosynthetic process
• GO:0050922 negative regulation of chemotaxis
• GO:0051607 defense response to virus

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4ty0, PDBe:4ty0, PDBj:4ty0
• PDBsum: 4ty0
• PubMed: 25131990
• UniProt: Q9KVG7|DNCV_VIBCH Cyclic GMP-AMP synthase (Gene Name=dncV)