Structure of PDB 4tu7 Chain B

Receptor sequence

>4tu7B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence]

GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQIN
QDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHVYQPLPGAHKLF
IGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINV
TDQAIAGLNGMQLGDKKLLVQRAS

3D structure

PDB

4tu7 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.

Chain

Resolution

2.087 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	B	K260 F262 G264 G265 V291 S294 K300 Y302 F304 K328 K329 Q333 A335	K98 F100 G102 G103 V129 S132 K138 Y140 F142 K166 K167 Q171 A173
BS02	rna	B	R150 Y152 K195 N196 F197 F199 K225 R227 P229 H230 V231	R8 Y10 K53 N54 F55 F57 K83 R85 P87 H88 V89
BS03	CPQ	B	Q274 E277 G326	Q112 E115 G164

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4tu7, PDBe:4tu7, PDBj:4tu7
PDBsum	4tu7
PubMed	25422459
UniProt	P26368\|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]