Structure of PDB 4tsq Chain B

Receptor sequence
>4tsqB (length=178) Species: 396334 (Actinia fragacea) [Search protein sequence]
ADVAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTY
FRSGTSDIVLPHKVAHGKALLYNGQKNRGPVATGVVGVIAYSMSDGNTLA
VLFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHS
RGLGYGLKSRGFMNSSGHAILEIHVTKA
3D structure
PDB4tsq Structural basis for self-assembly of a cytolytic pore lined by protein and lipid
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HXG B W112 Y113 W116 Y137 Y138 P142 W111 Y112 W115 Y136 Y137 P141
BS02 HXG B R53 S54 T84 G85 P107 Y108 Y113 Y133 Y137 R52 S53 T83 G84 P106 Y107 Y112 Y132 Y136
BS03 HXG B R53 Y133 E134 Y138 R52 Y132 E133 Y137
BS04 HXG B N111 W112 S114 R144 N110 W111 S113 R143
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0015267 channel activity
GO:0042802 identical protein binding
GO:0090729 toxin activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0031640 killing of cells of another organism
GO:0035821 modulation of process of another organism
GO:0046931 pore complex assembly
GO:0051715 cytolysis in another organism
GO:0055085 transmembrane transport
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0042151 nematocyst
GO:0044218 other organism cell membrane
GO:0046930 pore complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tsq, PDBe:4tsq, PDBj:4tsq
PDBsum4tsq
PubMed25716479
UniProtB9W5G6|ACTPC_ACTFR DELTA-actitoxin-Afr1a

[Back to BioLiP]