Structure of PDB 4s18 Chain B

Receptor sequence
>4s18B (length=122) Species: 9913 (Bos taurus) [Search protein sequence]
KETAAAKFERQHMDSSTASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLA
DVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQA
NKHIIVACEGNPYVPVHFDASV
3D structure
PDB4s18 Interactions of carboplatin and oxaliplatin with proteins: Insights from X-ray structures and mass spectrometry studies of their ribonuclease A adducts.
ChainB
Resolution2.27 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H12 K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) H12 K39 H117 F118 D119
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1PT B K41 H119 K39 H117
BS02 1PT B D14 Y25 M29 D14 Y23 M27
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004522 ribonuclease A activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0016829 lyase activity
Biological Process
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4s18, PDBe:4s18, PDBj:4s18
PDBsum4s18
PubMed26239545
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]