Structure of PDB 4rhx Chain B

Receptor sequence
>4rhxB (length=175) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]
AELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRSATTGQDLLLITVLKG
AVLFVTDLARAIPVPTQFEFMAVSSVRILKDLDRDIHGRDVLIVEDVVDS
GLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVV
GYGLDYDERYRDLSYIGTLDPRVYQ
3D structure
PDB4rhx First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity.
ChainB
Resolution2.0322 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E122 D123 D126 F175 R188
Catalytic site (residue number reindexed from 1) E95 D96 D99 F148 R161
Enzyme Commision number 2.4.2.8: hypoxanthine phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3QF B K66 G67 V90 D126 S127 G128 T130 K154 F175 V176 L181 D182 R188 K49 G50 V73 D99 S100 G101 T103 K127 F148 V149 L154 D155 R161 MOAD: Ki=1.6uM
PDBbind-CN: -logKd/Ki=5.80,Ki=1.6uM
BS02 MG B E122 D123 E95 D96
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0046872 metal ion binding
GO:0052657 guanine phosphoribosyltransferase activity
Biological Process
GO:0006166 purine ribonucleoside salvage
GO:0006177 GMP biosynthetic process
GO:0006178 guanine salvage
GO:0006188 IMP biosynthetic process
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0043101 purine-containing compound salvage
GO:0046100 hypoxanthine metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rhx, PDBe:4rhx, PDBj:4rhx
PDBsum4rhx
PubMed25915781
UniProtP9WHQ9|HGPRT_MYCTU Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=hpt)

[Back to BioLiP]