Structure of PDB 4ret Chain B

Receptor sequence

>4retB (length=290) Species: 9823 (Sus scrofa) [Search protein sequence]

KFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISE
FKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYK
DLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLN
DETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHC
TGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQF
TNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

3D structure

PDB

4ret Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	17F	B	I35 L36 Y39	I22 L23 Y26

Gene Ontology

	Molecular Function
GO:0001671	ATPase activator activity
GO:0005391	P-type sodium:potassium-exchanging transporter activity
GO:0005515	protein binding
GO:0030674	protein-macromolecule adaptor activity
GO:0051117	ATPase binding

	Biological Process
GO:0006813	potassium ion transport
GO:0006814	sodium ion transport
GO:0006883	intracellular sodium ion homeostasis
GO:0007155	cell adhesion
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient
GO:0030007	intracellular potassium ion homeostasis
GO:0036376	sodium ion export across plasma membrane
GO:0045087	innate immune response
GO:0055085	transmembrane transport
GO:0086009	membrane repolarization
GO:1902600	proton transmembrane transport
GO:1903278	positive regulation of sodium ion export across plasma membrane
GO:1903288	positive regulation of potassium ion import across plasma membrane
GO:1903408	positive regulation of P-type sodium:potassium-exchanging transporter activity
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0005886	plasma membrane
GO:0005890	sodium:potassium-exchanging ATPase complex
GO:0016324	apical plasma membrane
GO:0042383	sarcolemma

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ret, PDBe:4ret, PDBj:4ret
PDBsum	4ret
PubMed	25624492
UniProt	P05027\|AT1B1_PIG Sodium/potassium-transporting ATPase subunit beta-1 (Gene Name=ATP1B1)

[Back to BioLiP]