Structure of PDB 4r6z Chain B |
>4r6zB (length=94) Species: 226900 (Bacillus cereus ATCC 14579) [Search protein sequence] |
KDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPP PQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
|
PDB | 4r6z A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLY |
B |
S108 V111 R113 |
S89 V92 R94 |
|
|
|
|