Structure of PDB 4r4e Chain B

Receptor sequence
>4r4eB (length=84) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFS
FHDVDKLLEIKHLIEQGVNMAGIKQILAKAEAEP
3D structure
PDB4r4e Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
ChainB
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G15 R26 R29 R41 N45 R46 R47 G15 R26 R29 R41 N45 R46 R47 PDBbind-CN: Kd=8.1nM
BS02 dna B S24 R26 Q27 Y30 R46 S24 R26 Q27 Y30 R46 PDBbind-CN: Kd=8.1nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4r4e, PDBe:4r4e, PDBj:4r4e
PDBsum4r4e
PubMed25691471
UniProtP37582|GLNR_BACSU HTH-type transcriptional regulator GlnR (Gene Name=glnR)

[Back to BioLiP]