Structure of PDB 4qvb Chain B

Receptor sequence
>4qvbB (length=144) Species: 1138877 (Mycobacterium tuberculosis 7199-99) [Search protein sequence]
QVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAE
PRAKTRNLRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEAL
IALYRNIAGEHSDWDDYRQAMVTDRRVLLTLPISHVYGLPPGMR
3D structure
PDB4qvb Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.-.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F42 B W77 S78 Y79 H138 Y140 L142 W74 S75 Y76 H135 Y137 L139 MOAD: Kd=170uM
BS02 F42 B K26 H27 Q32 R55 A56 K57 R59 N60 K23 H24 Q29 R52 A53 K54 R56 N57 MOAD: Kd=170uM
BS03 PDO B E83 H138 E80 H135
Gene Ontology
Molecular Function
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
GO:0030170 pyridoxal phosphate binding
GO:0042803 protein homodimerization activity
GO:0070402 NADPH binding
GO:0070967 coenzyme F420 binding
GO:0071949 FAD binding
Biological Process
GO:0042816 vitamin B6 metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4qvb, PDBe:4qvb, PDBj:4qvb
PDBsum4qvb
PubMed25644473
UniProtO06553|F420R_MYCTU F420H(2)-dependent reductase Rv1155 (Gene Name=Rv1155)

[Back to BioLiP]