Structure of PDB 4qn9 Chain B

Receptor sequence
>4qn9B (length=322) Species: 9606 (Homo sapiens) [Search protein sequence]
SKKGKDGRFVNPWPTWKNPSIPNSSVPSSKEELDKELPVLKPYFITNPEE
AGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRR
SPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLD
WMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLW
GSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFM
KYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALER
YGLNAEDFFVLKHGESRYLNND
3D structure
PDB4qn9 Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids.
ChainB
Resolution2.652 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.4.54: N-acetylphosphatidylethanolamine-hydrolyzing phospholipase D.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DXC B Y159 M160 Y92 M93 PDBbind-CN: -logKd/Ki=4.41,Kd=38.5uM
BS02 DXC B W218 K221 W151 K154 PDBbind-CN: -logKd/Ki=4.41,Kd=38.5uM
BS03 DXC B Y188 R257 Y121 R190 PDBbind-CN: -logKd/Ki=4.41,Kd=38.5uM
BS04 ZN B H185 H187 H253 D284 H118 H120 H186 D217
BS05 ZN B D189 H190 D284 H343 D122 H123 D217 H276
BS06 DXC B K256 L259 K189 L192 PDBbind-CN: -logKd/Ki=4.41,Kd=38.5uM
BS07 DXC B G161 P162 A348 G94 P95 A281 PDBbind-CN: -logKd/Ki=4.41,Kd=38.5uM
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0032052 bile acid binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity
Biological Process
GO:0001523 retinoid metabolic process
GO:0001659 temperature homeostasis
GO:0009395 phospholipid catabolic process
GO:0048874 host-mediated regulation of intestinal microbiota composition
GO:0050729 positive regulation of inflammatory response
GO:0070291 N-acylethanolamine metabolic process
GO:0070292 N-acylphosphatidylethanolamine metabolic process
GO:0090336 positive regulation of brown fat cell differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0016020 membrane
GO:0030868 smooth endoplasmic reticulum membrane
GO:0031901 early endosome membrane
GO:0042622 photoreceptor outer segment membrane
GO:0042734 presynaptic membrane
GO:0045211 postsynaptic membrane
GO:0070062 extracellular exosome
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qn9, PDBe:4qn9, PDBj:4qn9
PDBsum4qn9
PubMed25684574
UniProtQ6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D (Gene Name=NAPEPLD)

[Back to BioLiP]