Structure of PDB 4qja Chain B |
>4qjaB (length=99) Species: 11685 (HIV-1 M:B_ARV2/SF2) [Search protein sequence] |
PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGI GGFIKVRQYDQIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 4qja Structural basis and distal effects of Gag substrate coevolution in drug resistance to HIV-1 protease. |
Chain | B |
Resolution | 1.54 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
G27 A28 D29 G48 |
G27 A28 D29 G48 |
|
|
|
|