Structure of PDB 4qi1 Chain B

Receptor sequence

>4qi1B (length=228) Species: 362976 (Haloquadratum walsbyi DSM 16790)

LGVEGEGIWLALGTIGMLLGMLYFIADGLDVQDPRQKEFYVITILIPAIA
AASYLSMFFGFGLTEVSLANGRVVDVYWARYADWLFTTPLLLLDIGLLAG
ASQRDIGALVGIDAFMIVTGLVATLTKVVVARYAFWTISTISMVFLLYYL
VAVFGEAVSDADEDTRSTFNALRNIILVTWAIYPVAWLVGTEGLALTGLY
GETLLFMVLDLVAKVGFGFILLRSRAIM

3D structure

• PDB: 4qi1 Structural and Functional Studies of a Newly Grouped Haloquadratum walsbyi Bacteriorhodopsin Reveal the Acid-resistant Light-driven Proton Pumping Activity.
• Chain: B
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MPG	B	I122 F125	I112 F115
BS02	RET	B	W94 T98 W146 S149 T150 W190 Y193 P194 W197 K224	W84 T88 W136 S139 T140 W180 Y183 P184 W187 K214
BS03	MPG	B	E48 I59	E38 I49
BS04	MPG	B	T74 W88 L135 K137	T64 W78 L125 K127
BS05	MPG	B	T147 V154 F155 Y158	T137 V144 F145 Y148
BS06	MPG	B	L157 Y158 V161 E166	L147 Y148 V151 E156
BS07	MPG	B	M31 G38 I54 A61	M21 G28 I44 A51

Gene Ontology

Molecular Function

• GO:0005216 monoatomic ion channel activity
• GO:0009881 photoreceptor activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007602 phototransduction
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:4qi1, PDBe:4qi1, PDBj:4qi1
• PDBsum: 4qi1
• PubMed: 26483542
• UniProt: Q18DH8|BACR1_HALWD Bacteriorhodopsin-I (Gene Name=bop1)