Structure of PDB 4qgp Chain B |
>4qgpB (length=107) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] |
IHHHHHHMEELLDILREFRDSRGWLKYHTPKNLAVSISIEVAELLEIFQW TRSSDEEFEVLERRKGEVEEEIADVLIYLLFLCDVAEINPIEAVKRKMEK NERKYPK |
|
PDB | 4qgp Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus DSM 4304 at 1.80 A resolution |
Chain | B |
Resolution | 1.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
E33 E36 E64 D67 |
E40 E43 E71 D74 |
|
|
|
|