Structure of PDB 4qfd Chain B

Receptor sequence

>4qfdB (length=315) Species: 9606 (Homo sapiens) [Search protein sequence]

MRVVVIGAGVIGLSTALCIHERYHLDIKVYADRFTPLTTTDVAAGLWQPY
LPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDT
VLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFF
QRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM
KHFILTHDIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCC
RLEPTLKNARIIGERTGFRPVRPQIRLEREQTEVIHNYGHGGYGLTIHWG
CALEAAKLFGRILEE

3D structure

PDB

4qfd Novel human D-amino acid oxidase inhibitors stabilize an active-site lid-open conformation.

Chain

Resolution

2.85 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L51 G313 T317
Catalytic site (residue number reindexed from 1)	L46 G292 T296
Enzyme Commision number	1.4.3.3: D-amino-acid oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	G7 A8 G9 V10 I11 A36 D37 R38 T44 T45 A48 G50 L51 V164 T182 W185 G281 R283 G312 G313 Y314 G315 L316 T317	G7 A8 G9 V10 I11 A31 D32 R33 T39 T40 A43 G45 L46 V154 T172 W175 G267 R269 G291 G292 Y293 G294 L295 T296
BS02	31R	B	Q53 Y55 Y224 S226 Y228 R283	Q48 Y50 Y210 S212 Y214 R269

Gene Ontology

	Molecular Function
GO:0003884	D-amino-acid oxidase activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0042802	identical protein binding
GO:0071949	FAD binding

	Biological Process
GO:0006562	proline catabolic process
GO:0007586	digestion
GO:0019478	D-amino acid catabolic process
GO:0036088	D-serine catabolic process
GO:0042416	dopamine biosynthetic process
GO:0046416	D-amino acid metabolic process
GO:0055130	D-alanine catabolic process
GO:0070178	D-serine metabolic process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005777	peroxisome
GO:0005782	peroxisomal matrix
GO:0005829	cytosol
GO:0042995	cell projection
GO:0045202	synapse
GO:0048786	presynaptic active zone

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qfd, PDBe:4qfd, PDBj:4qfd
PDBsum	4qfd
PubMed	25001371
UniProt	P14920\|OXDA_HUMAN D-amino-acid oxidase (Gene Name=DAO)

[Back to BioLiP]