Structure of PDB 4qfc Chain B

Receptor sequence

>4qfcB (length=323) Species: 9606 (Homo sapiens) [Search protein sequence]

MRVVVIGAGVIGLSTALCIHERYHSPLDIKVYADRFTPLTTTDVAAGLWQ
PYLSDPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPS
WKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERG
VKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVD
APWMKHFILTHDPGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNT
IWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLTEVIHNYGHGGY
GLTIHWGCALEAAKLFGRILEEK

3D structure

PDB

4qfc Novel human D-amino acid oxidase inhibitors stabilize an active-site lid-open conformation.

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L51 G313 T317
Catalytic site (residue number reindexed from 1)	L48 G299 T303
Enzyme Commision number	1.4.3.3: D-amino-acid oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	G7 G9 V10 I11 A36 D37 R38 T44 T45 A48 G50 L51 V164 T182 G183 G281 R283 G312 G313 Y314 G315 L316 T317	G7 G9 V10 I11 A33 D34 R35 T41 T42 A45 G47 L48 V158 T176 G177 G273 R275 G298 G299 Y300 G301 L302 T303
BS02	31T	B	Q53 Y55 L215 Y224 Y228 R283 G313	Q50 Y52 L209 Y216 Y220 R275 G299	MOAD: Ki=9.6nM

Gene Ontology

	Molecular Function
GO:0003884	D-amino-acid oxidase activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0042802	identical protein binding
GO:0071949	FAD binding

	Biological Process
GO:0006562	proline catabolic process
GO:0007586	digestion
GO:0019478	D-amino acid catabolic process
GO:0036088	D-serine catabolic process
GO:0042416	dopamine biosynthetic process
GO:0046416	D-amino acid metabolic process
GO:0055130	D-alanine catabolic process
GO:0070178	D-serine metabolic process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005777	peroxisome
GO:0005782	peroxisomal matrix
GO:0005829	cytosol
GO:0042995	cell projection
GO:0045202	synapse
GO:0048786	presynaptic active zone

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qfc, PDBe:4qfc, PDBj:4qfc
PDBsum	4qfc
PubMed	25001371
UniProt	P14920\|OXDA_HUMAN D-amino-acid oxidase (Gene Name=DAO)

[Back to BioLiP]