Structure of PDB 4qao Chain B

Receptor sequence

>4qaoB (length=106) Species: 4932 (Saccharomyces cerevisiae)

FKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYS
YTDANIKKNVLWDENNMSEYLTNPAKYIPGCGMAHGGLKKEKDRNDLITY
LKKASE

3D structure

• PDB: 4qao Understanding PDZ Affinity and Selectivity: All Residues Considered
• Chain: B
• Resolution: 2.103 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	R13 C14 C17 H18 V28 G29 I35 S40 Y48 T49 D50 W59 Y67 K73 I75 G83	R16 C17 C20 H21 V31 G32 I38 S43 Y51 T52 D53 W62 Y70 K76 I78 G86

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:4qao, PDBe:4qao, PDBj:4qao
• PDBsum: 4qao
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)