Structure of PDB 4q9m Chain B

Receptor sequence
>4q9mB (length=228) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence]
QVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVI
TVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDR
LPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDA
KINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAY
SELYFTDTLWPDFDEAALQEAILAYNRR
3D structure
PDB4q9m Discovery and structural characterization of an allosteric inhibitor of bacterial cis-prenyltransferase.
ChainB
Resolution2.06 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D28 H45 L139
Catalytic site (residue number reindexed from 1) D11 H28 L122
Enzyme Commision number 2.5.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 2ZW B M49 Q53 I87 P91 Y95 Y98 V99 L102 A129 F143 M32 Q36 I70 P74 Y78 Y81 V82 L85 A112 F126 MOAD: Kd=66nM
BS02 FPP B M27 D28 G29 N30 G31 R32 R41 H45 A71 R79 I87 M10 D11 G12 N13 G14 R15 R24 H28 A54 R62 I70
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004659 prenyltransferase activity
GO:0008834 di-trans,poly-cis-undecaprenyl-diphosphate synthase activity
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0030145 manganese ion binding
GO:0045547 dehydrodolichyl diphosphate synthase activity
GO:0046872 metal ion binding
Biological Process
GO:0016094 polyprenol biosynthetic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4q9m, PDBe:4q9m, PDBj:4q9m
PDBsum4q9m
PubMed25287857
UniProtQ8DRB3|ISPT_STRR6 Isoprenyl transferase (Gene Name=uppS)

[Back to BioLiP]