Structure of PDB 4q5p Chain B

Receptor sequence

>4q5pB (length=104) Species: 4932 (Saccharomyces cerevisiae)

AGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYT
DANIKKNVLWDENNMSEYLTNPAKYIPGCGMAFGGLKKEKDRNDLITYLK
KASE

3D structure

• PDB: 4q5p A Compact Structure of Cytochrome c Trapped in a Lysine-Ligated State: Loop Refolding and Functional Implications of a Conformational Switch.
• Chain: B
• Resolution: 1.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	C14 C17 H18 L32 I35 S40 G41 Y48 T49 D50 Y67 L68 K73 G83 L85 L94	C15 C18 H19 L33 I36 S41 G42 Y49 T50 D51 Y68 L69 K74 G84 L86 L95

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:4q5p, PDBe:4q5p, PDBj:4q5p
• PDBsum: 4q5p
• PubMed: 26038984
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)