Structure of PDB 4pwi Chain B |
>4pwiB (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAMHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDRYTIAALLSP YSYSTTAVVTN |
|
PDB | 4pwi Inhibitory Activities of Propolis and Its Promising Component, Caffeic Acid Phenethyl Ester, against Amyloidogenesis of Human Transthyretin |
Chain | B |
Resolution | 1.494 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ROA |
B |
M13 K15 T106 L110 S117 |
M4 K6 T93 L97 S104 |
BindingDB: EC50=8600nM |
|
|