Structure of PDB 4pmf Chain B

Receptor sequence

>4pmfB (length=117) Species: 9606 (Homo sapiens)

KCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGL
TTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
ALLSPYSYSTTAVVTNP

3D structure

• PDB: 4pmf Transthyretin complexes with curcumin and bromo-estradiol: evaluation of solubilizing multicomponent mixtures.
• Chain: B
• Resolution: 1.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CUR	B	K15 T106 L110 S117 T118 T119 V121	K7 T98 L102 S109 T110 T111 V113
BS02	EDO	B	F64 A97 Y105	F56 A89 Y97

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4pmf, PDBe:4pmf, PDBj:4pmf
• PDBsum: 4pmf
• PubMed: 25224922
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)