Structure of PDB 4pm1 Chain B

Receptor sequence

>4pm1B (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 4pm1 Transthyretin complexes with curcumin and bromo-estradiol: evaluation of solubilizing multicomponent mixtures.
• Chain: B
• Resolution: 1.23 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EDO	B	T96 Y105	T87 Y96
BS02	EDO	B	F64 N98 R103	F55 N89 R94
BS03	ESZ	B	K15 L17 A108 L110 S117 T119	K6 L8 A99 L101 S108 T110

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4pm1, PDBe:4pm1, PDBj:4pm1
• PDBsum: 4pm1
• PubMed: 25224922
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)