Structure of PDB 4pli Chain B |
>4pliB (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRL DCLLKHS |
|
PDB | 4pli Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression. |
Chain | B |
Resolution | 1.651 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
Y67 Y87 W90 W94 |
Y17 Y37 W40 W44 |
|
|
|
|