Structure of PDB 4p8e Chain B

Receptor sequence

>4p8eB (length=217) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

SHMNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAV
ESLTTAQMALMIRECSGIVCLCLTEAQADRLALPPMVVNNNSANQTAFTV
SIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPLRARAGGV
LARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNM
PVLTIEDMVQYRIQFDL

3D structure

• PDB: 4p8e Structural Basis for Competitive Inhibition of 3,4-Dihydroxy-2-butanone-4-phosphate Synthase from Vibrio cholerae.
• Chain: B
• Resolution: 2.04 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E39 D43 C68 N92 F96 E101 H137 H154 E175
• Catalytic site (residue number reindexed from 1): E41 D45 C70 N94 F98 E103 H139 H156 E177
• Enzyme Commision number: 4.1.99.12: 3,4-dihydroxy-2-butanone-4-phosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5RP	B	R38 E39 D43 C68 T94 F96 R151 G153 H154 T155 L173 E175	R40 E41 D45 C70 T96 F98 R153 G155 H156 T157 L175 E177
BS02	ZN	B	E39 H154	E41 H156
BS03	ZN	B	E62 H196	E64 H198

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003824 catalytic activity
• GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity
• GO:0016829 lyase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009231 riboflavin biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4p8e, PDBe:4p8e, PDBj:4p8e
• PDBsum: 4p8e
• PubMed: 25792735
• UniProt: Q9KKP2|RIBB_VIBCH 3,4-dihydroxy-2-butanone 4-phosphate synthase (Gene Name=ribB)