Structure of PDB 4owx Chain B

Receptor sequence
>4owxB (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISV
WDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSE
VPNFSEP
3D structure
PDB4owx Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G13 K15 T32 K33 W55 D56 Y74 F78 Y85 T86 R88 G9 K11 T28 K29 W51 D52 Y70 F74 Y81 T82 R84 PDBbind-CN: Kd=8.2uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0061730 C-rich strand telomeric DNA binding
GO:0070182 DNA polymerase binding
GO:0098505 G-rich strand telomeric DNA binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0010212 response to ionizing radiation
GO:0044818 mitotic G2/M transition checkpoint
GO:0070200 establishment of protein localization to telomere
GO:1904355 positive regulation of telomere capping
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0035861 site of double-strand break
GO:0070876 SOSS complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4owx, PDBe:4owx, PDBj:4owx
PDBsum4owx
PubMed24630995
UniProtQ9BQ15|SOSB1_HUMAN SOSS complex subunit B1 (Gene Name=NABP2)

[Back to BioLiP]