Structure of PDB 4ov2 Chain B

Receptor sequence
>4ov2B (length=163) Species: 10116 (Rattus norvegicus) [Search protein sequence]
LKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFP
FGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKL
YDLDNDGYITRNEMLDIVDAIYQMVGNTVENTPEKRVDRIFAMMDKNADG
KLTLQEFQEGSKA
3D structure
PDB4ov2 Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B D73 N75 D77 R79 E81 E84 D66 N68 D70 R72 E74 E77
BS02 CA B D109 D111 D113 Y115 E120 D102 D104 D106 Y108 E113
BS03 CA B D157 N159 D161 K163 E168 D145 N147 D149 K151 E156
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005245 voltage-gated calcium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008048 calcium sensitive guanylate cyclase activator activity
GO:0008427 calcium-dependent protein kinase inhibitor activity
GO:0019901 protein kinase binding
GO:0046872 metal ion binding
Biological Process
GO:0010975 regulation of neuron projection development
GO:0045921 positive regulation of exocytosis
GO:0050850 positive regulation of calcium-mediated signaling
GO:0070588 calcium ion transmembrane transport
GO:0099509 regulation of presynaptic cytosolic calcium ion concentration
GO:2000300 regulation of synaptic vesicle exocytosis
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0030424 axon
GO:0030425 dendrite
GO:0031045 dense core granule
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0048471 perinuclear region of cytoplasm
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ov2, PDBe:4ov2, PDBj:4ov2
PDBsum4ov2
PubMed
UniProtP62168|NCS1_RAT Neuronal calcium sensor 1 (Gene Name=Ncs1)

[Back to BioLiP]